SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006628 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006628
Domain Number 1 Region: 66-177
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.87e-31
Family Ferredoxin reductase FAD-binding domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 166-312
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.68e-24
Family Reductases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006628   Gene: ENSMPUG00000006682   Transcript: ENSMPUT00000006741
Sequence length 314
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896928.1:6189696:6212864:-1 gene:ENSMPUG00000006682 transcript:ENSMPUT00000006741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDEREEDADEEAWLQLRPVEPLPSQCCGSGCSPCVFDLYHQELAKWEAARASKDRSLLS
GEESQSCPSKLSPETFLAFRISAMDRLTEDTYCVRFALPRNCQLGLRPGQHLILRGKVDG
LEIQRAYTPISPANAEGYFEVLIKCYPTGLMSQYVRSWSTGDTAFWRGPFGDFFYKANQY
GELLMLASGTGLAPMVPVLQTITDNAEDETFVTLVGCFKTFEGIYLKTFLQEQARFWNVR
TFFVLSQENSLEKLPQSYQEKTRFGRLAQGLIEELVGSCRRKPFALVCGSAEFTKDMAKC
LLCAGLAEDSYFLF
Download sequence
Identical sequences M3Y5M7
ENSMPUP00000006628 XP_004751646.1.14098 ENSMPUP00000006628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]