SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006665 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006665
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily PapD-like 4.97e-41
Family MSP-like 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006665
Domain Number - Region: 164-195
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0641
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006665   Gene: ENSMPUG00000006719   Transcript: ENSMPUT00000006778
Sequence length 243
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896972.1:4481650:4532833:1 gene:ENSMPUG00000006719 transcript:ENSMPUT00000006778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI
IDAGASVNVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLR
CVFELPAENDKPHDVEINKILPTTASKTETPAVSKALSSSLDDSEVKKVLEECKRLQGEV
QRLRDENKQFKEEDGLRMRKTVQSNSPVPAFAAAGKEEGPSARLLALVVLFFIVGVIIGK
IAL
Download sequence
Identical sequences M3Y5R4
ENSMPUP00000006665 ENSMPUP00000006665 XP_004759984.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]