SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007293 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007293
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.24e-30
Family alpha-mannosidase, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007293   Gene: ENSMPUG00000007350   Transcript: ENSMPUT00000007412
Sequence length 200
Comment pep:novel scaffold:MusPutFur1.0:GL897053.1:212318:218727:1 gene:ENSMPUG00000007350 transcript:ENSMPUT00000007412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWLLLGPRPLTAGLHQRSGLALQHRPIVLLRELNETAQNHPSPQQQEPVTLPPSLHLQIL
SIPGWNYSSNHRKHLQNLQKGHGRKAKADLRRVLLRLHHLYEVGEDPVLSQPVSVNLEVV
LQGLGPVVEVEERSLTGTWDVSTLHRWSWRTRDGPHSRGSSSSHLTSLQGMKVTIYPKEI
RTFFIHFCSSELLVDSVNSG
Download sequence
Identical sequences M3Y7I6
ENSMPUP00000007293 ENSMPUP00000007293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]