SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007355 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007355
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily Sema domain 3.01e-28
Family Sema domain 0.0097
Further Details:      
 
Domain Number 2 Region: 192-244
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000111
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007355
Domain Number - Region: 409-495
Classification Level Classification E-value
Superfamily E set domains 0.000815
Family E-set domains of sugar-utilizing enzymes 0.096
Further Details:      
 
Domain Number - Region: 498-530
Classification Level Classification E-value
Superfamily E set domains 0.0602
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007355   Gene: ENSMPUG00000007413   Transcript: ENSMPUT00000007475
Sequence length 708
Comment pep:novel scaffold:MusPutFur1.0:GL896921.1:6941243:7029963:-1 gene:ENSMPUG00000007413 transcript:ENSMPUT00000007475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRIAQSAKVLQFQGQAALDCGHGHPDGRRLLLSSSLVEALGVWAGVFSAATGEGQERRS
PATTALCLFRMSEIQERAKSCPWDFQTAEQNCKEGEQPERVQPIASSTLIHSDLTSVYGT
VVMNRTVLFLGTGDGQLLKVVLGENLTSNCPEVIYEIKEETPIFYKLVPHPKKNIYIYLT
AGKEVRRIRVANCSRHPSCTECLTAADPHCGWCHSLQRCTFKEDCVHPENHENWLDISSG
AKKCPQINLFRSSKDKTTVTVVGSFPPRRAEWECAVKSADTGRQLCRGKSPPSKPCTCSI
PTRATYKDVLVVNVTFSVGSWRLSKRFNFTNCSSLRECPVCIGTGCAWCKSERKCIHPFT
ACDPSDYKRSQEHCPVTVEKRTPPETAGGGRFKENRSNRTHSGLQVFYIKSIEPRKISTL
GKSNVIVTGANFTQASKITMILKGTSTCEKDVIQVSHVLNDTHMKFSLPSSRKEMKEVCI
QFDGGNCTSVGPLSYIALPHCSLIYPATTWISGGQNITIVGRNFDVIDNLIISHELKGNI
NVSEYCVTDSCRFLAPSLKSSKARTNVTVKLRVQDTFLDCGSLQYLEDPRFTGCRVEPEG
DTELEVKIQKENDEFNISKTDIEITLFHGENEQLNCSFENITRNQDLTIILCKIKGINNA
NSIDTSSKKVRVSYLRVLPIDYTLFEALAWRHRSQNGICHRSLALSFK
Download sequence
Identical sequences M3Y7P8
ENSMPUP00000007355 ENSMPUP00000007355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]