SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007597 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007597
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-27
Family Fibronectin type III 0.0000104
Further Details:      
 
Domain Number 2 Region: 1816-1983
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-26
Family Fibronectin type III 0.00000908
Further Details:      
 
Domain Number 3 Region: 1635-1806
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-25
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 4 Region: 908-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 5.24e-24
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 727-891
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 1265-1438
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-21
Family Fibronectin type III 0.00000938
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-21
Family Fibronectin type II module 0.0000509
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-17
Family Fibronectin type III 0.00000329
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000103
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 11 Region: 2251-2294
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000552
Family Fibronectin type III 0.00000434
Further Details:      
 
Domain Number 14 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 230-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000196
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000275
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2206-2249
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000767
Family Fibronectin type I module 0.0033
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000236
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2294-2335
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000115
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 23 Region: 2120-2183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000353
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 24 Region: 1094-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000798
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007597   Gene: ENSMPUG00000007652   Transcript: ENSMPUT00000007718
Sequence length 2387
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897025.1:517311:582761:1 gene:ENSMPUG00000007652 transcript:ENSMPUT00000007718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPRLLLLAVLSLGTAVPPTGASKSKRQAQQIVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDSWSKKDNRGNLLQCICTGNGRGEWKCERHASVQTTSTGSGPFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTPNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPGRWKEATIP
GHLNSYTIKGLTPGVVYEGQLISVQHYGHREVTRFDFTTTSTSPPVTSNTVTGETTPLSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPAVDRVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRSDKVPPPRDLQFVEVTDVKITIMWSPPESAVTGYRVDVIPVNLPGEHGQRLPISRNA
FAEVTGLSPGVTYHFKVFAVNQGRESKPLTAEQTTKLDAPTNLQFTNETDTTVLVTWTPP
RARIAGYRLTVGPTRGGQPKQYNVGPSASQYPLRNLQPASEYTASLVAVKGNQQSPKVTG
VFTTLQPLSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIVV
SGLTPGVEYVYTISVLRDGKERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPLNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYAVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHTGGRPREDRVPPS
RNSITLTNLNPGTEYVVSIVALNGREESPPLIGQQSTVSDVPRDLEVIAATPTSVLISWE
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGADYTITVYAVTGRGDSPA
SSKPISIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPGPSKTKT
TGPDQTEMTIEGLQPTVEYVVSVYAQNQDGESPPLVQTAVTTIPAPADLKFTQVTPTSLT
AQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSIYALKDTL
TSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQR
TIRPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSL
LVSWQPPRAKITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGIEYTIQVIALKNN
QKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGT
SGQQPSVGQQMIFEEHGFRRTTPPTTATPVRHRPRPYPPNVNEEIQVGHVPRGDVDHHLY
YPHGMGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGTDEEPLQFRVPGTSASAT
LTGLTRGATYNIIVEALKDQKRHKVREEVVTVGNSVDQGLNQPTDDSCFDPYTVSHYAVG
EEWERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTC
LGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGA
EPGHEGSTGHYNQYSQRYHQRTNTNVNCPIECFMPLDVQADRDDSRE
Download sequence
Identical sequences M3Y8E0
ENSMPUP00000007597 XP_004767050.1.14098 ENSMPUP00000007597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]