SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007647 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007647
Domain Number 1 Region: 29-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-64
Family Eukaryotic proteases 0.0000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007647   Gene: ENSMPUG00000007703   Transcript: ENSMPUT00000007769
Sequence length 260
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:7184764:7193851:-1 gene:ENSMPUG00000007703 transcript:ENSMPUT00000007769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRISCMFLASSLSIAVFLLLIPGDFCVEIIGGNQVTPHSRPYMVLLKGKNVCAGALVAKD
WVLTAAHCVLNKNSQVILGAHSITKRESEKQIMYIKKEFPYPCFDPHTHEGDLKLLQLNK
KAKINKNVRILPLPKKGDDVKPETTCQVAGWGSIRNNSPQSDTLREVNITIINRRICNDE
KHYNYNPVIGLNMICAGSLKGGKDSCNGDSGSPLICEGIFRGITAFGLPGKCGDPRGPGI
YTLLSQKHLNWTIATMKGFV
Download sequence
Identical sequences M3Y8J0
XP_004744715.1.14098 ENSMPUP00000007647 ENSMPUP00000007647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]