SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007840 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007840
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007840   Gene: ENSMPUG00000007898   Transcript: ENSMPUT00000007965
Sequence length 305
Comment pep:known scaffold:MusPutFur1.0:GL896967.1:780361:790647:1 gene:ENSMPUG00000007898 transcript:ENSMPUT00000007965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVHSSGQVHAFGNCTDSDVLEEDAEVYELRSRGKEKIRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LYPPKGRQALRPSSVQYVPEQQEILLANDSLSSTESADNFLKEVDRDIEQIVKCTDTKRE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIVTPVFYLLYY
EILAKVDVSHHSTVDSSHLHSGVTPPSQQREVENGIGPTKGIPFGQHDHKLYRQDSQSPA
AQHKT
Download sequence
Identical sequences G9K930
ENSMPUP00000007840 ENSMPUP00000007840 XP_004759158.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]