SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008008 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008008
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.09e-57
Family Ran-binding protein mog1p 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008008   Gene: ENSMPUG00000008067   Transcript: ENSMPUT00000008134
Sequence length 186
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6062944:6064133:-1 gene:ENSMPUG00000008067 transcript:ENSMPUT00000008134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPARDYPLFGGAFSAALPPGALDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQG
EEAARYHFEDVGGVQGARSVQVDSVQPLLLENLALRSCCQEAWVLSGKQQVAKENHQVAK
DVTVHQALLRLPQYQTDLLLTFNDPPPDHRLSLGPENLSLPPWSLGDFKQLVTGLTLHDP
NIFGPQ
Download sequence
Identical sequences M3Y9K1
ENSMPUP00000008008 ENSMPUP00000008008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]