SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008188 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008188
Domain Number 1 Region: 47-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.58e-90
Family Carbonic anhydrase 0.00000000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008188   Gene: ENSMPUG00000008250   Transcript: ENSMPUT00000008319
Sequence length 303
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:1604124:1626890:1 gene:ENSMPUG00000008250 transcript:ENSMPUT00000008319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGRSLRNASGFSASVTQLWGAPRGHPRRPERCCSQGPCAQRNRSDAWHPLWKGPASVPG
GTRQSPVNIHWRDSVYDPQLQPLRVSYAAASCLHVWNTGYFFQVEFDDSAEESGICGGPL
ENHYRLKQFHFHWGATDERGSEHTVDGRVYPAELHLVHWNSVKYRNYTDAVVGENGVAVI
GVFVKLGARHEELQKLVRVLPEIKLKGARAAVGPFQPSCLLPACRDYWTYPGSLTTPPLS
ESVTWIVQKRPIEVAQDQLAAFRTLLSSALGEEERSMVDNYRPLQPLMNRKVRSSFQAAE
GGI
Download sequence
Identical sequences M3YA31
ENSMPUP00000008188 ENSMPUP00000008188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]