SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008203 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008203
Domain Number 1 Region: 1340-1479
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.96e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000171
Further Details:      
 
Domain Number 2 Region: 384-468
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000205
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008203   Gene: ENSMPUG00000008265   Transcript: ENSMPUT00000008334
Sequence length 1485
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:3750443:3760437:-1 gene:ENSMPUG00000008265 transcript:ENSMPUT00000008334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGHLPPPLCAPPAGPQSHSSPHPSLQAERGCRSAEGPGLNPNASVAQRCGFSHPVPQF
LELPLVPWLRLPQLPRLPQLPQLAGHPGRSIKPSSPCDCSLRASRTTHVPTRPCAGGGLL
SGPRAALPSLPEALCSPTAWPQAGAGPSTLTFSGGLLHPSAACFRAGPPASRPGAVFPAG
AGVLTRRAPPRPTEHVPSELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLE
TPPSPSALLALLARRGTVPALPERPVQEADLRHQPILMGAHLAVIDALMVAFAFEWTKTL
PGPLALASLEHKLLFWVDTTIRRLQEKTEQEAAQRASPAAPADGVAPAQPSCPTRWYWKL
VPIRYRKDRAVARRAPCFPNVTTLQDLASGAALAATIHCYCPQLLRLEEVCLKDPMSVAD
SLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKVNLVVLLAEMFMCFEVLKPDFVQAK
DLPDGHGQARPDPAFSAAAASPRATEASPAQNSSGCRVSLRGGGGFLPSLGTAPELGDTL
CSTPGRGDPLPVEGPPWLTCISWQLSRLQLPPPAPVTRRPPVPTPGIHRLTEVLPVHVPH
GGPRQGLESAAQAVSFSTPFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPVPARTPVQPTP
EPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEGSSKLPLASSYPLEGASKPLPD
GPTKAPTYVPHPEGPLKPSPCPAGEVSKSLALSEGSPKAAASSPAASNSEVKMTSFAERK
KQLVKAEAEAGSPAATPTAPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLG
KSAFLQVQPREAGGEAEAEPGPVPGGERPAGEGQGDPSPRPKAVTFSPELGPVPPEGLGD
YNRAVSKLSAALSSLQRDMQRLTDQQQRLLAPPEAPGPAPPPAAWVIPGPTAGPKAASPS
PARRAPAARRSPGPGPSPTPRSPKHARPAELRLAPLTRVLTPPHDVDSLPHLRKFSPSQV
PVQTRSSILLAEGSPPEEPVARPGLIEIPLRSLAEPAAEDEGDGSPPGAEDSLEEEASSE
GEPRAGLGFFYKVSVPQAGGGRDPLAGQGGGTLVDKRSDPLHKAKEGCVVSRWGGQRSTR
GGWPAGLGACPQDEDKPEDEMAQKRASLLERQQRRAEEARRRKQWQEAEKEQRREEAARA
PAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRAAGTGGPGRGGRRAPRPRSGCCD
DSALARSPARGLLGSRLSKVYSQSTLSLSTVANEAPNNLGVKRPTSRAPSPSGLMSPSRL
PGSRERDWDNGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKN
RILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELTRLAGYGPRTVTPAMVEGIYKY
NSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences M3YA46
ENSMPUP00000008203 ENSMPUP00000008203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]