SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008412 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008412
Domain Number 1 Region: 26-498
Classification Level Classification E-value
Superfamily Sema domain 6.93e-170
Family Sema domain 0.000000000000151
Further Details:      
 
Domain Number 2 Region: 500-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000314
Family Plexin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 560-651
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000489
Family I set domains 0.0000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008412   Gene: ENSMPUG00000008476   Transcript: ENSMPUT00000008547
Sequence length 857
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897185.1:767929:792418:1 gene:ENSMPUG00000008476 transcript:ENSMPUT00000008547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAPVGGLLAALAMVLGMAVAFAPKPRITWEHREVHLEKFHEPGIFNYSVLLLSEDKTTL
YVGAREAVFALSAHNVSEKQHEAYWKVSEDKKAKCAEKGKSRQTECLNYIRVLQPLGPGA
LYVCGTNAFQPACDHLDLTSFRFLGRREDGKGRCPFDPAQSYTSVMVDGELYSGTSYNFL
GSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVMRERPDGLDSGDDRVYFFFTEVSVEY
EFVFKLMIPRVARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSNLVFNVLQDVFVLRAE
GLKEPVIYGVFTPQLNNVGLSAVCAYHLSAAEEVFSRGKYMQSTTVEQSHTKWVRYNGAV
PTPRPGACITREARAANLSSSLSLPDKTLQFVKDHPLMDSSVTPIDNRPRLIRSDVNYTQ
VVVDRTWALDGTPYDVMFVGTDQGTLHKAVSLENEAHIIEETRLFQDLEPVQTLLLNSQK
GRKFVYAGSSSGVVQAPVAFCEKHATCEDCVLARDPYCAWSPASQACVALHLPDSPSRDL
IQRMSGDTAGCPNKTKESFRQHFFKHGGTAELKCSPKSNLARVVWTFQNNELKAEGPKYS
LVGRKDLLVFNLSEGDSGVYRCLLEERLRNRTVLHVAARHVLEVRVPPRTPAAPTTPAEG
DRTPLRVSAEPTPGPPAQTPVVLGPALGAMAPPPSPTPSSTPCKPKTVVNTVPQVHSEKT
VYLKSSDNRLLMVLFLLCFVLCLGLLSYNCYKGYLPGQCLKFRSAVLLAKKQPAADFSEF
EQSVKETLVEQGSFSQQNGAQPRPALDTGYETEQDTTASRAPTDREDSQRLDDLPGRDRP
FDVKCELKYADSDADVD
Download sequence
Identical sequences M3YAQ5
ENSMPUP00000008412 XP_012904586.1.14098 ENSMPUP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]