SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008491 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008491
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000085
Family Ribosomal L11/L12e N-terminal domain 0.00079
Further Details:      
 
Domain Number 2 Region: 67-132
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000458
Family Ribosomal protein L11, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008491   Gene: ENSMPUG00000008556   Transcript: ENSMPUT00000008627
Sequence length 156
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:28208919:28209687:-1 gene:ENSMPUG00000008556 transcript:ENSMPUT00000008627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPPKFDPNKIRVLLRLVVGKLVPPLPWPQDGPSGSISKKAWGDDTTKTTSDWGMRIPVKL
TVQNRVVPSASPMIFKALKESKRQTQKNIKDSVAIIFDEIVNIAQQMQHQPFTREFSGTI
KEMLGIVQSVSCSFDGHHLHDIIDGISSGTIGCLTT
Download sequence
Identical sequences M3YAY4
ENSMPUP00000008491 ENSMPUP00000008491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]