SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008535 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008535
Domain Number 1 Region: 206-316,429-574
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.62e-56
Family Phosphate binding protein-like 0.00000855
Further Details:      
 
Domain Number 2 Region: 7-192
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000659
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008535   Gene: ENSMPUG00000008603   Transcript: ENSMPUT00000008674
Sequence length 777
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897014.1:2439972:2695288:-1 gene:ENSMPUG00000008603 transcript:ENSMPUT00000008674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVFFFFSLQAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQ
KCMRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCI
RKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKL
ATWDSEKGLNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLD
ALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDF
SKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQ
SVAQPRPSASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANL
AAFLTVSRMDNPIRTFQDLSKQVDISYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTI
SKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSVSSKGYGI
ALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPHLGRCDLTSPPSAQADGKALKLHSFA
GVFCILAIGLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQ
ISPASIELSALEMGGLAPSQALEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPGSSLP
LALSSSATMPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences M3YB28
ENSMPUP00000008535 ENSMPUP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]