SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008545 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008545
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.01e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 1.4e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 4 Region: 116-170
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-20
Family Fibronectin type II module 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008545   Gene: ENSMPUG00000008614   Transcript: ENSMPUT00000008685
Sequence length 794
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:32250733:32300216:1 gene:ENSMPUG00000008614 transcript:ENSMPUT00000008685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRVGLTLLLCAVLLGSASASSDEEGNQDESLDSKTSLSSDEPVKDHNTAGRVVAGQIF
LDSEESELESPIQEEEDSVRSQEGESVAEEIRFLESPNPENKDYEEPTKVRKQALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIQ
TAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPLPRPPGPRPV
PAQQEGPPEQQPPQ
Download sequence
Identical sequences M3YB38
ENSMPUP00000008545 XP_004739178.1.14098 ENSMPUP00000008545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]