SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008974 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008974
Domain Number 1 Region: 31-322
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-105
Family Inorganic pyrophosphatase 0.0000000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008974   Gene: ENSMPUG00000009047   Transcript: ENSMPUT00000009122
Sequence length 325
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896920.1:11013015:11088838:1 gene:ENSMPUG00000009047 transcript:ENSMPUT00000009122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSYPITKVGNIFKIRISVSSEDKIVSVTKVDYFGKPRYGLFAENVAGHYISPFHDIPLK
VDSTEENGIPTKRARNDEHENLFNMVVEVPRWTNAKMEIATEEPLNPIKQDIKNGKLRYV
ANIFPHKGYIWNYGALPQTWEDPHQKDKSTDCCGDNDPIDVCEIGSKVLSCGEIIHVKIL
GILALIDQGETDWKIIAINVNDPEASKFHDIDDVKKYKPGYLEATLNWFRFYKVPEGKPE
NQFAFNGEFKNKAFALEVIKSTHECWKTLLMKKCDGGAISCTNVQVCGSPFHCTQEEARS
IVELVSSSPNKGSKEEEQVWHFLGK
Download sequence
Identical sequences M3YCB7
ENSMPUP00000008974 ENSMPUP00000008974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]