SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009102 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009102
Domain Number 1 Region: 44-444
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.12e-161
Family Phosphoglycerate kinase 0.00000000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009102   Gene: ENSMPUG00000009179   Transcript: ENSMPUT00000009255
Sequence length 479
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897064.1:4405430:4425441:1 gene:ENSMPUG00000009179 transcript:ENSMPUT00000009255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDNDEQKGAGQGERRWKVPPIQQHWDLAFSFCLYIVKMSLSKKLTLDKLDVKGKRVIMR
VDFNVPMKKNQITNNQRIKASIPSIKYCLDNGARSVVLMSHLGRPDGVPMPDKYSLEPVA
AELKSLLGKEVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGQDPSGNKLKA
EPDKIKAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVDLPQKASGFLMKKELEYFAKALE
NPERPFLAILGGAKVADKIQLIQNLLDKVNEMIIGGGMAFTFLKVLNNMEIGASLFDEEG
AKIVKDIMAKASEKGVNITFPVDFVTADKFEENAKVGHATVASGIPAGWMALDCGPETNK
KNVQVVTQARLIVWNGPVGVFEWDAFAKGTKALMDEIVKATSRGCITIIGGGDTATCCAK
WNTEDKVSHVSTGGGASLELLEGDIPNRNPHFHYRTWSRVTLRRWEDRMEERQTWRAKA
Download sequence
Identical sequences M3YCP5
ENSMPUP00000009102 ENSMPUP00000009102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]