SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009565 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009565
Domain Number 1 Region: 335-512,547-713
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.43e-84
Family YicI catalytic domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 1209-1401,1446-1607
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.65e-73
Family YicI catalytic domain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 91-334
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-51
Family YicI N-terminal domain-like 0.0057
Further Details:      
 
Domain Number 4 Region: 958-1205
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.01e-47
Family YicI N-terminal domain-like 0.0053
Further Details:      
 
Domain Number 5 Region: 1610-1690
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.81e-16
Family Putative glucosidase YicI, domain 3 0.035
Further Details:      
 
Domain Number 6 Region: 716-796
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.24e-16
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009565   Gene: ENSMPUG00000009641   Transcript: ENSMPUT00000009721
Sequence length 1830
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897096.1:2158030:2256852:-1 gene:ENSMPUG00000009641 transcript:ENSMPUT00000009721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKKFTGLEISLIVLFAIVTIIAIALIAVLATKTPAVEEISNSTSTPPTTRTTTVYPGP
SDAKCPSELNDHINERINCIPEQYPYKEAVCAMRGCCWKPWNDSIIPWCFFADNHGYNAD
KVTTTSTGLEATLNRISSPTLFGDDVSSALFIAQNQTRNRFRFKITDPSNRRYEVPHQFV
GEFTGTAASDTLYEVQVTENPFSIKVIRKSNRRILFDTSIGPLVYSDQYLQISTKLPSEY
IYGIGEHIHKRFRHDLNWKTWPIFTRDQLPGDNNNNLYGHHTFFMCIEDNSGKSFGVFLM
NSNAMEIFIQPTPIITYRVIGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAYWSLGFQL
SRWNYKSLDVLKEVVKRNRDAGIPFDTQVTDIDYMEAKKDFTYDKVAFQGLPEFVQDLHN
NGQKYVIILDPAISINKLTNGAAYETYNRGNAKNVWVNESDGTTAVIGEVWPGLTVFPDF
TNPNCIDWWADECNIFYQEVKYDGLWIDMNEVSSFIQGSKNGCESNKLNYPPFTPDILDK
LLYSKTICMDTVQYWGKHYDVHSLYGYSMAIATEKAIEKVFTNKRSFILTRSTFAGSGRY
AAHWLGDNTASWEQMKWSIAGMLEFNLFGIPLVGADICGFVANTTEELCRRWMQLGAFYP
FSRNHNGDIYEHQDPAFFGQNSLLVNSSKHYLNIRYTLLPFLYTLFYKAHMFGETVARPV
LHEFYEDMNTWSEDTQFLWGPALLITPVLKEGADTVSAYIPNATWFDYETGAKRPWRKQQ
VNMYLPGDKIGLHLRGGYIIPIQQPAVTTTASRKNPLGLIVALDEDNTAKGDFFWDDGET
KNTIQNGNYILYTFSVSNNKLDILCTHSSYQEGTTLAFETIKILGLTDSVTQVTVVEDNQ
PIKDHYNFTYTASDQNLLIYNLNFNLGRNFTVQWNQNYSVNERFTCYPDADPATKEKCEA
RGCLWETVPLSSQAPDCYFPRQYNPYLVSSTQYSSMGITTDLQLNPTRAQIKLPSDPIST
LRVEVKYHKNDMLQFKIYDPQNKRYEVPVPLNIPTTPTSTYENRLYDVEIKENPFGIQVR
RRSTGKVIWDSYLPGFAFNNQFIQISTRLPSEYIYGFGEVEHTTFKRDLNWHTWGMFTRD
QPPGYKLNSYGFHPYYMALEDEGYAHGVLLLNSNAMDVTFQPTPALTYRIIGGILDFYVF
LGPTPEIATQQYHEVIGRPVMPPYWALGFQLCRYGYRNTSEVEQVYNDMVAAQIPYDVQY
TDIDYMERQLDFTIDENFHDLPQFVDKIRQEGMRYIIILDPAISGNETKPYPAFERGMEK
DVFVKWPNTSDICWAKVWPDLPNITIDESLTEDEAVNASRAYVAFPDFFRNATAEWWARE
IIDFYNNQMRFDGLWIDMNEPSSFVHGTVSNQCRNKELNYPPYFPELTKRANGLHFRTMC
METEQILSDGSSVLHYDVHNLYGWSQMKPSYDALQKTTGKRGIVISRSTYPTGGQWGGHW
LGDNYAQWDNLDKSIIGMMEFSLFGISYTGADICGFFNNSEYELCARWMQLGAFYPYSRN
HNIAFTRRQDPASWNATFSEMSRNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFFN
DKITWDIFKQFLWGPAFLVTAVLEPSVKSVIGYVPDARWFDYHTGQDIKVRGQFHEFYTP
LDTINLHVRGGHILPCQEPDKNTFHSRKNYMKLIVAADNNQTAQGSLFWDDGESIDTYEK
GLYFLAQFNLNKNTLTSTILKNGYINKNEMRLGFINIWGKGKTAVNEVILIYNGNREVVK
FSENLDKEILNINLTVNDVTLDQPIQISWS
Download sequence
Identical sequences M3YE08
ENSMPUP00000009565 ENSMPUP00000009565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]