SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009621 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009621
Domain Number 1 Region: 365-695
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.83e-130
Family Transferrin 0.000000000186
Further Details:      
 
Domain Number 2 Region: 23-352
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.71e-125
Family Transferrin 0.00000000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009621   Gene: ENSMPUG00000009697   Transcript: ENSMPUT00000009777
Sequence length 696
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896986.1:5244422:5275688:-1 gene:ENSMPUG00000009697 transcript:ENSMPUT00000009777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVRTLLACAVLGLCLAVSPEKTVRWCTVSNHEASKCSSFMENMKTVLENGPFVSCVK
KTSYLECIKAIWANEADAVTLDAGLVFEAGLNPYNLKPVVAEFYESGGDQKTQYYAVALV
KKSSNFNLNELEGKKSCHTGLGRSAGWNIPMGLLYWKLPEPRDSLQKAVSSFFAGSCVPC
ADRTAFPKLCQLCAGKGADKCACSNHEPYFGYSGAFKCLMDDAGDVAFVKHSTVFENLPN
EADRDEYRLLCPDTLQRMTVDKYKDCHLARVPSHAVVARSVGGKEDLIWELLNQAQEHYG
KDKSKAFQLFGSPLGKDLLFKDSAQGFLRIPSKMDTWLYLGYDYVTALRNLREDVRPDTP
RDECKKVKWCAIGHHERVKCDEWSINSEGKIECETAESTEDCIAKIAKGEADAMSLDGGF
IYIAGQCGLVPVLAENYRYKAVAVVKASADESLTWNNLQGKKSCHTAVERTAGWNIPMGL
LYSRINHCEFDKFFQEGCAPGSMQNSSLCALCIGSASSPGKECLPNNHERYYGYTGAFRC
LVEKGDVAFVKDQTVMQNTEGRNTEDWAKNLKEKDFQLLCPDGSRKPVSDADNCFLAKAP
NHAVVSRKDKASCVSKTLLEQQTMFGGNGNDCSGKFCLFHSETKDLLFRDDTKCLAKLPE
STTYESYLGAAYVRAVANMRQCSTSKLLEACNFHRF
Download sequence
Identical sequences M3YE64
ENSMPUP00000009621 ENSMPUP00000009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]