SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009786 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009786
Domain Number 1 Region: 1-75,243-367,413-545
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.94e-38
Family ADP-ribosylglycohydrolase 0.004
Further Details:      
 
Domain Number 2 Region: 2183-2357
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-37
Family Ypt/Rab-GAP domain of gyp1p 0.009
Further Details:      
 
Domain Number 3 Region: 2336-2454
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009786   Gene: ENSMPUG00000009861   Transcript: ENSMPUT00000009945
Sequence length 2478
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896915.1:590964:645693:1 gene:ENSMPUG00000009861 transcript:ENSMPUT00000009945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFKAAMLLGAVGDALGHRHAHKDNSASRKKVQEGLQTSGSLDQRPLSPETWPVSDNTI
MHLTTAGALTTGMPSAAGSKIAQEQHFEKLTFLLQNELLWAFCLLYADVGWDACGGFVSG
LVFAETEREGGEGLKHKTVAILFLNLALDLWLPSSLGSGRSRNPRSLPHDPTRQAGGAGG
TWPVLTWVELWVLSGLCCVARVKPVQAIHPQGATTVGGRSPEASSSSAHVGPRTLSFPDY
WCLDDLYREMVRRYVEVLEKLPEHWADPATLEGCSQLKPDNYLLAWHTPFNEKGLRSTGG
QLGLPGATADTQASIHTSPGFILRITLDCLPFKLVFHQSQESSRCCHHPPPGEMAQASVS
MWEGSAVACRHTLGPRDPGTAPSLRGKPSPFPVAPHQAGLMHTQGTFRSEYQEHWFYFEA
KWQFYLEERKISDDSGSKAVFPDRYDAEERDKAYRKWSSEGRGGRRGHDAPMIAYDALLG
AGDSWTELCHRAMCHGGESGATGTIAGCLFGLLHGLDGVPADLYEDLEHREELSRLGEAL
YRLSTEENRDLHARKTRPRPGSSCTMASAGSSGTHPSGRGFPQWGVGQQPEPWEVCPHSS
KHGKTCGSEKPVDVQALRKKVSSVTCGPAARAVLSSLLLYITDLQDRPPEPLPARRAEGG
ESRASHSPESQDAHRRPTCFQLLQAKFMGTGREFRLKKAREVGRLISKDKQGPGRSLVTA
TINKLLDKAREGAGHPMQDREPPPSQKPRQGLPAGKGTVKNILKMFLAAEKKEFCEEPTA
AKGPLPKPTKRGSMLSKLREKFEQSGCLCSEAGVLPLRTEGRKKKNLVSKKTHRPETRTL
STATIASTCLGTPLARFLACTAEPVLAFNIATVVCGPRSWLSHCAKISHSRQRHVLRGGT
GTSPSMGVIGDGQGQPSGEPTQPPAPWATALGDSLEMAFLGEGTKPIPGLAPSPASHRGG
PLPGHEPAGSLLKPASPARARAMGGDGTGSPPAGDTVQHTMAPGEAGPGLWQELQNTGAG
VAPKFALTVCSSEDETEGVGLGSEEDLQFALQETFPEQKEAGHIPPLPAPAVQALQGTQS
ALESPQITVTRLVTYQVPPAPATPPQAGASPHVTVPRLDTCATPPQAVVSPYVTVPRLDT
CQVPPAPATLHQASGGGDRSSSLLSSEGKGRGGFENARGAFPMGTGSENIRAASTVGGPL
QVLSVPPARGATSMGQDLPAAAPQQCPTQGMANTHGFGDSKELQHPEGRAGEDVSEPACK
KHQWPASGDRLVHGRDTPWHHPMTSGNRQTGDSPSVPDHQRELPTQAGHPVGVSAALGAT
PSDRTQSDSSTTGEEKILCGHELGGLPRGDSAQPGEQATGSTSPGLGSDSPAPLIERPQP
APGAPRREAATRATESHTAPAAGSVLKSVDSVARGRDLAQEPGGCPLPAFPSLAAVALTQ
ASSPPHSSAPTRCSEHLLESSTRVGLGQRWPEPPESPATVPLQAADTPLRPAEPRVSVVA
ESKASVVAGGRGVPVVHGSPCGGVMTRIPGGAPPTPLGSAAVEPPPSGNQQAEEDKHVLP
KEQVPPGAGAPCQPPPPGAAGGQWVGGALQKGPDPPAHSPSVSLMRAGVQDRVEVGDRHQ
PRVGQGALEEGAAGPVRLDGPPDRGVALWGQKPGPQAIKKGQTQPREVKVGRGAEVGATE
VGTGHPCTGKVPEHAQGQRARPAERPPWGHSAQAGKNQEPSPPEKPGHPAQAQAGRTAPH
IAAGPADSSSEAASAVGGRRRSCRPAPRGSQAEAGAPHQVAESQPMVGRSPWSSGPEPAP
GSTGPTPKPGGCEMPCAPAQEGPPEAPEAESGAWEHVRRGRLAHFAKYRAQSFSDQRSFD
LSFRPTTIRANDTFELPKGRLRYPARCAVGEFLLVKTPRSPPGSQAGGGWGSVLQVQREK
HRNEGVLPAGQTLLLLLLCSKVDKAVTFHPQNRSYHSIFSLKCSLHVFREVVFLFLLLFS
KTTLGMRRAEAAKAFTKDKSILNLPPTSHHLSKPKCTTALAGLPGSRARLEPRPQSESAA
GRNGAGPQWAGPRGARARETLSGAHGFLSSWGRRVDPYGFERPEDFDYAAYEEFASAYLV
VLTRRAIKWSKLLKGRGRVQRSSTDRGPDLGWGAGRQDGRSFLLNHTAPQAFPLWPCGWG
LSASARLRRAARTSGSTAHSLSVKRYIRKGIPLEHRARIWMGVSGAQAQMDQNPGYYQRL
LQGEHDDRLEEAIRTAQNDFLKPSYSNVLRVNFPVDMNRTFPDNVKFRKSADPCLQKTLY
NVLLAYGRHNQGVGYCQGMNFVAGYLILVTQSEEEAFWLLDALVGRILPDYYSPAMLGLK
TDQEVLGELVRTKLPAVAALMDGHGVLWPLVVSRWFICLFVDILPVETVLRIWDCLFNEG
SKIIFRVALTLIKQHQAFILEGTSVVDICERFKAITRGSFVTECHTFMQKIFSEPGSLSM
ATISRLRASCRARLLAQG
Download sequence
Identical sequences M3YEM9
ENSMPUP00000009786 ENSMPUP00000009786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]