SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010344 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010344
Domain Number 1 Region: 17-339
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.76e-119
Family Aldose 1-epimerase (mutarotase) 0.0000000000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010344   Gene: ENSMPUG00000010420   Transcript: ENSMPUT00000010510
Sequence length 342
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:5705444:5761863:1 gene:ENSMPUG00000010420 transcript:ENSMPUT00000010510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVTRAVFGDLPSGAGTVEKFQLQSDLLKVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLPVNNGPNSLHGGVRGFDKVLWTP
QVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELMINYRAQASRTTPVNLTNHSYFN
LAGQGSPNIYDHEITIEADAFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQEFRIN
GFDHNFCLKGSKEKHFCARVRHAGSGRVLEVYTTQPGVQFYTGNFLDGTLQGKRGAVYPK
HSGFCLETQNWPDAVNQPHFPPVLLRPGEEYDHTTWFKFTVA
Download sequence
Identical sequences M3YG87
XP_004765562.1.14098 ENSMPUP00000010344 ENSMPUP00000010344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]