SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010347 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010347
Domain Number - Region: 22-62
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0745
Family YkuI C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010347   Gene: ENSMPUG00000010423   Transcript: ENSMPUT00000010513
Sequence length 78
Comment pep:novel scaffold:MusPutFur1.0:GL897265.1:451160:615672:1 gene:ENSMPUG00000010423 transcript:ENSMPUT00000010513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSEDDLVAGAPLHSPEWSEERFRVDRKKLEAMLQAAAEGKGKSGEDFFQKIMEETNTQ
IAWPSKLKIGAKSKKGKS
Download sequence
Identical sequences M3YG90
ENSMPUP00000010347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]