SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010435 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010435
Domain Number 1 Region: 356-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 91-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 177-231,259-274
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000712
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010435   Gene: ENSMPUG00000010512   Transcript: ENSMPUT00000010603
Sequence length 622
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897129.1:2238859:2344537:1 gene:ENSMPUG00000010512 transcript:ENSMPUT00000010603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQEAAARDRILLEENQCISPVVSSHMSPWTKPTAVGSLSPHVIEFPRKRKGSDSGPS
QSGIMTEKVVEKLSQNPFTYLLSTRIEISASRSSREAHSQTEKRRRDKMNNLIEELSAMI
PQCNPMARKLDKLTVLRMAVQHLKSLKGMTNSYAGGNYRPSFIQDNELRHLILKTAEGFL
FVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSSDLSPREKL
IDAKTGLQVHSNFHSGRMHVYSGSRRSFFCRIKSCKISVKEEHECLSTSKKKDHRKFCTI
HCTGYLRSWPPNIVGVEEERDKKKDGSNFTCLVAIGRLHPYIVPQNSGEIKVKPTEFITR
FAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKIFTDL
YKFRKKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHNEMKEVSLLPCSSQSSEES
SKQSCISVPGMSTGIVLGAGSLGADIVNEVLDFQRLQSSSSLDDSSPTNLMKDSHAINCR
KISKKEWIPVNPSEMGKSEATRQNQSADPPHNHGPLLGDSAQLDFDALCDNDDTAMAAFM
NYFEAEGGLGDPGDLGDIHWTL
Download sequence
Identical sequences M3YGH8
ENSMPUP00000010435 ENSMPUP00000010435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]