SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010443 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010443
Domain Number 1 Region: 1346-1484
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000537
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010443   Gene: ENSMPUG00000010520   Transcript: ENSMPUT00000010611
Sequence length 1490
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:4318467:4434596:1 gene:ENSMPUG00000010520 transcript:ENSMPUT00000010611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPGVVRIEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVNDMPS
IPVLNAAKTNILDSSCSSDFTSSGEGAAFMHSHHLPSRHSRPQAHSSASGGIRRSSSMSY
VDGFIGTWPKEKRSSVHGVSFDISFDKEHTVHKSTPNRGITRSISNEGLTLNNNRVSKNI
RKNLSFKPVNGEEEAESIEEELNIDSHSGLKSYTPLNTNDLNSNENIHYKLPNGALQNRV
LLDEFGNQIETPSIEEALQIIHDTEKSPHTSQPDHIANGFFLHNQEMSILNSNIKLNQSS
PDNITDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQ
DYDIRTSNPRDALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSS
SQKTTPEGSELNIPHVVAWGQIPEEAGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQK
KKMEAAFTKQRQKMGRTAFLTVVKKRGDGISPLREEAAGAEDEKVYTDRAKEKDSQKANG
QRSKSLADLKESLENPQAKWLKSPTTPVDPEKQWNLASPSEDTLNEGEILEYTKSIEKLN
SSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSRQAGLSSAIAPF
SSDSPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFS
PSQVPIQTRSFVCFGDDGEPQLKESKPKEEIKKEELESKGPAGQHVHNLEEKELKPLEST
VSEVLSQPITETVRLTPNEDQLNQPAEPPPKTVFPPAAPKNVNLIEVSLSDLKPPEKADV
AVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQ
LEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQIA
KQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLS
PSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVN
EGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIE
GLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences M3YGI6
XP_004756302.1.14098 ENSMPUP00000010443 ENSMPUP00000010443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]