SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010507 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010507
Domain Number 1 Region: 388-647
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 265-377
Classification Level Classification E-value
Superfamily Kringle-like 1.93e-31
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 101-150
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-17
Family Fibronectin type II module 0.0018
Further Details:      
 
Domain Number 4 Region: 162-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010507
Domain Number - Region: 199-238
Classification Level Classification E-value
Superfamily FnI-like domain 0.00214
Family Fibronectin type I module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010507   Gene: ENSMPUG00000010585   Transcript: ENSMPUT00000010676
Sequence length 656
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:1913688:1921620:-1 gene:ENSMPUG00000010585 transcript:ENSMPUT00000010676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWAWGRSLCPSLGMALFLLLLLLGFHGAQPQASRNLTEPPEPNATVSSGTPMIPVTLV
TPVSPATSAPEPEGPGGTGLTPPPRAAPSSSSPGGPGGSVLTEDGRPCRFPFRYGGRMLH
SCTSEGSAHRRWCATTHNYDRDRAWGYCAQTSVPREDPAAPDPCASSPCLNGGSCSNTQD
PESYHCTCPMAFTGKDCGTEKCFDETRYEHLEVGDRWARVSQGQVEQCECAEGQIRCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCSCPPGHAGRLCNIVPSQRCFVGNGTEYRGVAST
AASGLSCLAWNSDLLYQELHVDSVGTAALLGLGPHAYCRNPDKDERPWCYVVNGSALSWE
YCRLVACESLTRTPLRTPEVMLRQAEPAPGGRQACGKRHKKRSFLRPRIIGGSSSLPGSH
PWLAAIYIGNSFCAGSLVHTCWVVSAAHCFSSSPHRESVLVVLGQHFFNQTTDVTQTFGI
EKYIPYPMYSVFNPSDHDLVLIRLKKKGDRCAVRSQFVQPICLPEPSSPFSAGHKCQIAG
WGHQDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSG
GPLACEKNGVAYLYGVISWGDGCGRLNKPGVYTRVAKYVDWIKDRIWPPKRPADPS
Download sequence
Identical sequences M3YGQ0
ENSMPUP00000010507 ENSMPUP00000010507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]