SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010544 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010544
Domain Number 1 Region: 831-876
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000294
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 30-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000879
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010544   Gene: ENSMPUG00000010623   Transcript: ENSMPUT00000010714
Sequence length 1226
Comment pep:novel scaffold:MusPutFur1.0:GL896985.1:7498612:7549816:1 gene:ENSMPUG00000010623 transcript:ENSMPUT00000010714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVIEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWED
LVRRCIQKFHAQHEGEAVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRS
QTTNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPLSSSSPAHQAMCSGNPGQDMT
LGSNINFPINGPKEQMGMPMGRFGGSGGMNHVSSMQATTPQGSNYALKMNSPSQSSPGMN
PGQPNSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQ
ALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTPG
QAESSCHPGEQKETSDSSMPQAVSGERADGQTRLHDSKGQTKLLQLLTTKSDQMEPSPLS
SSLSDTNKDSTASLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQE
ANSTAPGSEVTVKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASN
TKLIAMKTEKEEMSFEPSEQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQA
IINDLMQLTAENSPVAPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTG
AGPFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMVGSNPPRPAMPSGEWAPQS
SAVRVTCAATTSAMNRPIQGGMIRNPTASLPMRPNSQPGPRQMLQSQVMNIGPSELEMNM
GGPQYSQQQAPPNQTAPWPESILPIDQASFASQNRQQFGSSPDDLLCPHPAAESPSDEGA
LLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFPSQDSNIMLEQKAAVFPQQYA
SQAQMAQGSYPAMQDPSFHSMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQ
AQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQV
QQRTLMMRGQGLNMTSSMVAPGGLPATLSNPRMPQANAQQFPFPPNYGISQQPDPGFTGA
TTPQSPLMSPRMAHTQSPMMQQSQANPAYQASSDMNGWAQGNMAGNSMFSQQSPPHFGQQ
ANTSMYNNNMNINVSMATNTGGMSNMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALR
GGNLFPNQLPGMDMIKQEGDASRKYC
Download sequence
Identical sequences M3YGT7
ENSMPUP00000010544 ENSMPUP00000010544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]