SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010684 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010684
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.67e-98
Family Carbonic anhydrase 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010684   Gene: ENSMPUG00000010772   Transcript: ENSMPUT00000010863
Sequence length 262
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:1789885:1823486:1 gene:ENSMPUG00000010772 transcript:ENSMPUT00000010863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYGEHNGPIHWNKFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDANSAKII
SNSGHSFSVDFDDTEDKSVLRGGPLSGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEHNSQLQKITDILDSIKEKGKQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLATFRTLLCTAEGEAAA
FLLSNHRPPQPLKGRKVRASFH
Download sequence
Identical sequences M3YH77
ENSMPUP00000010684 ENSMPUP00000010684 XP_004767018.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]