SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010687 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010687
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.19e-99
Family Carbonic anhydrase 0.000000000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010687   Gene: ENSMPUG00000010775   Transcript: ENSMPUT00000010866
Sequence length 261
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:1864590:1876340:-1 gene:ENSMPUG00000010775 transcript:ENSMPUT00000010866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNWGYDDKNGPEQWGKLYPIANGNKQSPIDIKTSETKHDTSLKPISISYDPATAKEI
INVGHSFHVNYEDNDNRSVLRGGPLSETYRLCQFHFHWGSTNDYGSEHTVDGVKYSGELH
LVHWNSAKYSSFAEAISQADGLAIIGVLMKVDRANPRLQKVLDALNAVKTKNKRAPFTNF
DPSTLLPSSLDYWTYSGSLTHPPLYESVTWIICKDSISISPEQLAQFRSLLSTVEGDKAV
PIHHNNRPPQPLNSRVVRASF
Download sequence
Identical sequences M3YH80
XP_004767019.1.14098 ENSMPUP00000010687 ENSMPUP00000010687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]