SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010774 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010774
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily LysM domain 0.00445
Family LysM domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010774   Gene: ENSMPUG00000010862   Transcript: ENSMPUT00000010953
Sequence length 297
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:5053141:5059504:-1 gene:ENSMPUG00000010862 transcript:ENSMPUT00000010953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKEVLTKTFQGPAIVCRTPTSHVYMFENGGGDSGDSSEEESHGVALRPRGKERQKKGA
HHPHQPGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSIKIPV
KNHGILTETHRELRPLLSPSSETRVTFEEQPDPDRAAVGAGALSSPLTDFFKGIDQNIER
VVQSEIFLNESYSAETSNQPLLPTSPKTPTNGADCGIQWWNAVFIMLLIGIVLPVFYLVY
FKIQATGEIPSSLNTTAVPNGSMSVSAVPGQAPRLAVPVPTVPSADSQFSQTTQAGN
Download sequence
Identical sequences M3YHG7
ENSMPUP00000010774 ENSMPUP00000010774 XP_004759885.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]