SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010828 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010828
Domain Number 1 Region: 25-506
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-182
Family ALDH-like 0.00000000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010828   Gene: ENSMPUG00000010914   Transcript: ENSMPUT00000011007
Sequence length 512
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:5876942:5913998:1 gene:ENSMPUG00000010914 transcript:ENSMPUT00000011007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPVRNLEVKFTQIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAHAAFQRGSPWRRLDALGRGWLLHQLADLVERDRAVLATLETM
DTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPAICCGNTIVVKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQISKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQIYAEFVKRSVEHAKKRLVGDPFDVRTEQGPQIDQK
QFDKILDLIESGKKEGAKLECGGSAMEDRGLFIKPTVFSEVTDTMRIAKEEIFGPVQPIL
KFKNIEEVIKRANSLEYGLTAAVFTKNLDKALKLASALESGTVWINCYNAIYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLDDKSP
Download sequence
Identical sequences M3YHM1
XP_004759897.1.14098 ENSMPUP00000010828 ENSMPUP00000010828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]