SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010889 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010889
Domain Number 1 Region: 57-183,257-751
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.61e-197
Family Aconitase iron-sulfur domain 0.00000000000032
Further Details:      
 
Domain Number 2 Region: 755-1008
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.43e-71
Family LeuD-like 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010889   Gene: ENSMPUG00000010978   Transcript: ENSMPUT00000011071
Sequence length 1010
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897313.1:248972:290483:-1 gene:ENSMPUG00000010978 transcript:ENSMPUT00000011071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGLWLSYWTAQVESICSTAKNSFGQSGFSSYFHFKLKYFVAVFNEIVIFFSGYPFEYLI
ETLNDSSRKKFFNVPRLGGTKYDVLPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWKTKQ
SNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKILGGDPRKVHPARPTDLTVDHSLQID
FSKCAIQNAPNPGGGDLQKAGKLSPLRAQPKKLPCRGQTTCRGPCESGEPGRNSGRFSSQ
IENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRVFKNVAVIPPGTGMAH
QVNLEYLSRVVFEEDDLLFPDSVVGTDSHITMVNGLGILGWGVGGIETEAVMLGLPVSLT
LPEVVGCELIGSSNPFVTSIDVVLGITKHLRQVGVAGKFVEFFGSGVSQLSIVDRTTIAN
MCPEYGAVLSFFPVDNVTLRHLEHTGFDKAKLESMETYLKAVKLFRHDQDSSGEPAYSQV
IRIHLNSIVASVSGPKRPQDRVAVTDMKRDFQACLNEKVGFKGFQIAAEKQKDNVSIRYE
GSEYTLSHGSVVMAAVTSCTNNCNPSVMLAAGLLAKKAVDAGLQVKPYIRTSLSPGSGMV
THYLSSSGVLPYLSKLGFEVVGYGCSTCVGNTAPLSEAVLSAVKQGDLVTCGVLSGNKNF
EGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDATGKSIYLQDIWPTREEVQQ
TEEERVTPSMFKALKEKMEMGNKRWNSLEAPDSVLFPWDLKSTYIRCPSFFDKLTKEPGA
LQPIENAHVLLFLGDAVTTDHISPAGSIARSSAAAKYLTNRGLTPREFNSYGARRGNDAV
MTRGTFANIKLFNKFLGKPAPKTIHFPSGQTLDVFEAAELYQKEGVPLIILAGKKYGSGN
SRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLTGRETYSLA
FPEELSPGVTLTMKTSTGKVFSVIASFDNDVEVALYKHGGLLNFVARKFS
Download sequence
Identical sequences M3YHT2
ENSMPUP00000010889 ENSMPUP00000010889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]