SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011078 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011078
Domain Number 1 Region: 50-518
Classification Level Classification E-value
Superfamily Sema domain 3.66e-157
Family Sema domain 0.0000000498
Further Details:      
 
Domain Number 2 Region: 514-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000453
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011078   Gene: ENSMPUG00000011169   Transcript: ENSMPUT00000011263
Sequence length 1082
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:13866126:13880656:1 gene:ENSMPUG00000011169 transcript:ENSMPUT00000011263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFLPCAYMLLLMISQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEIPKTEVIPSKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFRGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYKTSIDFPDETLAFIKSHPLMDSAVPPIADEPWFTKTRIRYR
LTAIAVDHTAGPHQNYTVIFVGSEAGVVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCNAE
NEEDRKVISLQLDKDHHAVYVAFSSCVIRLPLSRCERYGSCKKSCVASRDPYCGWLSQGT
CGRVTPGMLLLTEDFFAFHNHSAGGYEQDTEYGNTAHLGDCHEILPTSTTPDYKIFGGPT
SDMEVSSSSVTTMASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGVRWEVQ
SGESNQMVHMNVLITCVFAAFVLGAFIAGVAVYCYRDLFVRKNRKIHKDAESAQSCTDSS
GSFAKLNGLFDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAAL
PTPESTPVLHQKTLQAMKSHSDKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLP
NATHDYNTSFSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNS
NPKAIMGDIQMAHQTLMLDPVGPMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTP
GVPMTSLERQRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDY
IQGTPVSVHLQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTTSVRPLNKY
TY
Download sequence
Identical sequences M3YIC1
ENSMPUP00000011078 XP_004751381.1.14098 ENSMPUP00000011078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]