SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011201 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011201
Domain Number 1 Region: 40-489
Classification Level Classification E-value
Superfamily Sema domain 1.7e-138
Family Sema domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 836-894
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 782-833
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000119
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 485-537
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000811
Family Plexin repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 649-700
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 7 Region: 895-939
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000706
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 538-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011201   Gene: ENSMPUG00000011293   Transcript: ENSMPUT00000011389
Sequence length 1073
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896975.1:8290442:8637600:1 gene:ENSMPUG00000011293 transcript:ENSMPUT00000011389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTRAIAWLLSIVGWWRLAQLESDASQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQL
TFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRVL
LVGGDRLFTCGTNAFTPVCTNRSLNNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYA
ATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEHD
CGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPELD
LIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTVD
QGLYVNLTERNLQDAQKFILMHEVVQPVTSVPAFMEDNSRFSHMAVDVVQGRDMLVHIIY
LATDYGTIKKVRAPLAPAAGSCLLEEIELFPERRGQPIRSLQILHSQSVLFVGLQEHVAK
VPLKRCPFYRTRSACIGAQDPYCGWDMVMKKCTSLEESLSMTQWEQSTSTCPTRNLTVDG
HFGAWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPRMEIANCSRNGGWTPW
TSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWGP
WERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNPCPELKKTTPWTPWTPVNISDN
GGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAH
TVNGAWSAWTSWSQCSRDCSRGIRSRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVD
GVWSCWSPWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPESWSE
WSDWSECDASGVQVRARQCILLFPVGSQCSGNTTESRPCGFDSNYIPEVSVARSSSVEEK
RCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVAPAPLNTSITNH
INKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences M3YIP4
ENSMPUP00000011201 XP_004761284.1.14098 ENSMPUP00000011201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]