SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011419 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011419
Domain Number 1 Region: 151-403
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.67e-79
Family Glutamine synthetase catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 62-150
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.29e-20
Family Glutamine synthetase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011419   Gene: ENSMPUG00000011509   Transcript: ENSMPUT00000011607
Sequence length 414
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897029.1:2532553:2541706:-1 gene:ENSMPUG00000011509 transcript:ENSMPUT00000011607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQREPENQERRERNSKRRRAREGYPNDPIDLLWLGRTTSTMATSASSHLNKGIKQLYMS
LPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEWNFDGSSTFQSEGSNSDMYL
VPVAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTL
MGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMP
AQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTK
AMREENGLKYIEESIEKLSKRHHYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANR
GASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Download sequence
Identical sequences M3YJB2
ENSMPUP00000011419 XP_004767960.1.14098 ENSMPUP00000011419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]