SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011628 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011628
Domain Number 1 Region: 1267-1406
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.02e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000218
Further Details:      
 
Domain Number 2 Region: 99-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000181
Family Calponin-homology domain, CH-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011628   Gene: ENSMPUG00000011722   Transcript: ENSMPUT00000011820
Sequence length 1411
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:912568:941812:1 gene:ENSMPUG00000011722 transcript:ENSMPUT00000011820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWVNKVLWRL
REKSEMTEKELAIFKGTLFSFCRLQVRYRREHLSARQPPYFPLLEDLMRDGSDGAALLAV
VHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFANEYLNRCFYLTLEDMLYAPLVLKP
NVMVFIAELFWWFENVKPDFVQPRDVQELKDGTRSPGRPSSLPCAAALWPAVVTARAFVL
GGWPWEGLRWPSPLPPGPSRHAEGPQVPVSLRGKGASAFSPSHPLLPLRQRQQKAVQGEG
PPGKSPISPSPALCPFSCNLVKRSFSVDCSYCDVVILVRKVTVEYILICIVNMFIQNMFY
MFTSFINDMKCTENRCVFARQERVCVDVYLRSGYSGSRCGLMTELGVTHWNSRNLHRDAL
LSLGRNELLNPERPALPTRRSETPVQFFNPSRRSAPRCSTSVVGKKEQVSSACQIRLCVT
RSLGEHSGSPDGLHPWSTGQNCFLMALDPSALSSLWRSMELESDVGVRVDSRDNYKSVSY
YKLLVFWAILRQDSDSDVADLEEAEQDFVGEDPPVVTARCVGEEESAKLQEDMKGKEHED
KDDASGRSSPCLSTVSQVSSVSVASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPDA
SESCPAPLTTWKQRREQSPSRQSREHASLLASELAQLHMQLEEKRRAIETQKKKMEALSA
RQRLKLGKAAFLHVVKKGKAEGTPPPRKPDALVGEFAQHNGEAFDGEVCKSEELLLKDEG
REGVLVSPDVDAGGLLLLQPPRAKVPAALPELEKSKALSAALLEDAGEALDVSEGDLSIE
KLNETISTLQQAILRISQQQEQLLMKPPAVPGPKQNAQDQKVRAAIHFVEPLSPPGTTGH
RKPPRLGQGRNSRSGRPAELKVPKDRQQTSSRSKTPTPSRETLPHLRPFPARPPSDPGWD
SVAEPGNEAHDRCLFDSHRLHDEDNQRTFVLPPSKDTNILSEQAGLKEVLGSSVEEAALG
SPAVSGKENVPADEPPRSKASLIEVDLSDLKAPDEDGETEGPQSSADLASEGDQKPGVGF
FFKDEQKAEDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELRRDEARRKAEEDRARKE
EEKARRELIKQEYLRRKQQQILEEQGLGKPKAKPKKPQPKSVHREESCSDAATKCSSAPD
HLSRAQSGSSLSLASAATTEPESVHSGGTPSQRVESLEALPTLSRNPSRSTDRDWETASA
ASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANH
YIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAK
TMSVSVDALTIHNHLWQPKRPAVPKKTQTRK
Download sequence
Identical sequences M3YJX1
ENSMPUP00000011628 ENSMPUP00000011628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]