SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011655 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011655
Domain Number 1 Region: 86-270
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.7e-51
Family Isochorismatase-like hydrolases 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011655   Gene: ENSMPUG00000011749   Transcript: ENSMPUT00000011847
Sequence length 277
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:2587448:2608593:-1 gene:ENSMPUG00000011749 transcript:ENSMPUT00000011847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNGGLSITFCFSVFARPSSVPHGAGYELLIQKFLSLYGDQIDMHRKFVVQLFAEEWGQYV
DLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQ
RLLQGARMLGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTRFSMVIPEVEAALAEIPG
VRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTT
SEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences M3YJZ8
ENSMPUP00000011655 ENSMPUP00000011655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]