SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011726 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011726
Domain Number 1 Region: 97-233
Classification Level Classification E-value
Superfamily dUTPase-like 7.72e-49
Family dUTPase-like 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011726   Gene: ENSMPUG00000011820   Transcript: ENSMPUT00000011919
Sequence length 238
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:14402924:14415122:1 gene:ENSMPUG00000011820 transcript:ENSMPUT00000011919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLGPHPALRQHFFTSVLRLRAGPRAEAAGPPFRPLSSTRSRSRGCRGASNVGAGCQDA
PRRARGEAQRPAGPPRGLRETTPAPSPSKRPRPSEDGMRLRFVRLSEHATAPTKGSARAA
GYDLYSAYDYTLPPMEKALVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYR
GNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Download sequence
Identical sequences M3YK69
ENSMPUP00000011726 ENSMPUP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]