SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011793 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011793
Domain Number 1 Region: 259-440
Classification Level Classification E-value
Superfamily ITPase-like 1.05e-17
Family YjjX-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011793   Gene: ENSMPUG00000011883   Transcript: ENSMPUT00000011986
Sequence length 448
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:3978749:4010543:-1 gene:ENSMPUG00000011883 transcript:ENSMPUT00000011986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPHPAGLAAAASASTPLPLAATSSFSSPNVSSIQSLPPHAYSTPQ
PSLPPVRPSAPLPFVPPSPVPSVPALTTSVPPPVSPPPAAAFSNPPLSHFPASSSAQSTL
LSAPPSGPPTSGFSVGATYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQASLTSL
AQGPGTTSAITFPEEQEDPRVGRGQDEASAGGLWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVIGEAGQSNIAPQPV
GYAAGLKSSNGAPVGIQSLKRLGIVNVRKSLVSTSDIFKKLLVIKWFDIGCLIVEDPVHG
IHLETFTQATPVPLEFVQQAQSLTPQDYSLRWSGLLVTVGEVLEKSLVNVTRTDWHLTFT
GMSRRQMIYSAAKAIAGMYKQRLPPRTV
Download sequence
Identical sequences M3YKD6
ENSMPUP00000011793 ENSMPUP00000011793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]