SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011801 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011801
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily ALDH-like 0.0000353
Family ALDH-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011801   Gene: ENSMPUG00000011891   Transcript: ENSMPUT00000011994
Sequence length 62
Comment pep:novel scaffold:MusPutFur1.0:GL896941.1:2369469:2375274:-1 gene:ENSMPUG00000011891 transcript:ENSMPUT00000011994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQHQEELAAIEALRAGAVYTLALKNHVAMFIQTFCYFAGWCDKIQGLWHHHPLELPLML
LS
Download sequence
Identical sequences M3YKE4
ENSMPUP00000011801 ENSMPUP00000011801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]