SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011927 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011927
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 95-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000011
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000113
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011927   Gene: ENSMPUG00000012019   Transcript: ENSMPUT00000012122
Sequence length 868
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:9517927:9599592:1 gene:ENSMPUG00000012019 transcript:ENSMPUT00000012122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSESESEPEANQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKSGSGFGKKSKDTSTERDFFMRMKCTVTSRG
RTVNLKSATWKVLHCTGQVKVYSSCPPHGGLCSYKEPLLSCLILMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELVGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSGEVAVSDKSNCLFTKLKEEPEELAQLAPTAGDVIVSLDFESQS
FQGSSSYSNTLLPPSQPWPREPRSHSTQSEAGSLPAFTVPQVAASGSATPSATSSSSCST
PSSPGDYYTSLSDDLKIEVIEKLFTMDTEAKDQGSSQTDFSELDLETLAPYIPMDGEDFQ
LSPIYPEERLLPEKPQATPQHCFSTMTNIFQPLAPMASHSPFLLDKYQQQLGSKKIEPKH
QPMSSIFFDGGSKGSLPPCCGQTSTPLSSMGGRSNTQWPPDPPLHFGPTKWPATDQHTES
LGPSPLGAPITLPHLSMFKKRSTKGFGPQGPDVMSPAMVALANKLKLKRQREYEEQAFQD
MSGGDLSGSSTSHQVWKRVKSLRANGNCPLMPNKLLNANLPNDEFTQKPMRGLGQPLRHL
PLPPSAMNPGENAKSGFPPQCYAPPYQDYSLPSTPKVSGMASRLLGPSFEPYLLPELTRY
DCEVNVPVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences M3YKS0
ENSMPUP00000011927 XP_004753054.1.14098 ENSMPUP00000011927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]