SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011936 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011936
Domain Number 1 Region: 362-609
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-76
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 197-300
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-31
Family Kringle modules 0.00059
Further Details:      
 
Domain Number 3 Region: 34-89
Classification Level Classification E-value
Superfamily Kringle-like 8.34e-20
Family Fibronectin type II module 0.0036
Further Details:      
 
Domain Number 4 Region: 97-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011936
Domain Number - Region: 178-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0206
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011936   Gene: ENSMPUG00000012028   Transcript: ENSMPUT00000012131
Sequence length 610
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:4931753:4939255:1 gene:ENSMPUG00000012028 transcript:ENSMPUT00000012131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLFLGSLLGSLESALLIPPWKTPKEHKHRKDEHTVVLTVTGEPCYFPFQYNRQLYHK
CIHRGRPGPRPWCATTPNFEQDQQWGYCLEPKKVQADHCSKHSPCQKGGTCVNMPHGPHC
ICPEHFTGKHCEREKCFEPQLLQFFHEKEIWHRLEPAGVAKCQCKGPEAHCKLLATQVCR
TNPCLNGGSCLEAEGHLLCRCPAGYAGRMCDVDTEAHCYEGRGQDYRGRAATALSGARCR
PWASEATYQKVTAEQELNWGLGNHAFCRNPDNDTRPWCFVWSGDRLSWEYCRLARCRAPN
LAAPQNLSPSRVPSGHPDLPLPSLLALQKPQPPTPASGATPEQPISVPSSGCGQRLRKRL
SSLSRVVGGLVALPGAHPYIAALYWRHNFCAGSLIASCWVLTAAHCLQNRPAPEELTVVL
GQDRHNQSCEQCQTLAVRAYSLHEAFSPITYQHDLALLRLQETADGHCALPSPFVQPVCL
PSGAASPAEPEAALCEVAGWGHQFEGAGEYSSFLQEAQVPLISSERCSAPEVHGSSFTPG
MLCAGFLEGGTDACQGDSGGPLVCEDDATESQLILRGIISWGSGCGDRYKPGVYTDVASY
LTWIQEHINS
Download sequence
Identical sequences M3YKS9
ENSMPUP00000011936 ENSMPUP00000011936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]