SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012093 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012093
Domain Number 1 Region: 521-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-53
Family Protein kinases, catalytic subunit 0.0004
Further Details:      
 
Domain Number 2 Region: 41-253
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000109
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012093   Gene: ENSMPUG00000012189   Transcript: ENSMPUT00000012292
Sequence length 926
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897170.1:459565:474872:-1 gene:ENSMPUG00000012189 transcript:ENSMPUT00000012292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSAAGGCGPWPPLRLGLLLQLVALLRSPGPQVQTLRPESLLLVSTLDGSLHALSKQTGD
LKWTLKDDPVIQGPMYVTETAFLSDPADGSLYVLGTQKQQGLMRLPFTIPELVHASPCRS
SDGVFYTGRKQDAWFVVDPESGKTQMTLTTEGPSTPRLYIGRTQYTVTMHDHRTPALRWN
TTYRRYSAPPMDSLPGKYMSHLASCGMGLLLTVDPGSGVVLWTQDLGMPVMGIYTWHQDS
LRQLPHLTLARDTLHFLALRWGHIRLPASGPRDTATDFSTSDTPLLMTLYVGKDETGFYV
SKALVHTGVALVPRGLTLAPMDGPTTEEVTLQVSGERKGSPSTAVRYPSGSIALPSQWLL
IGYHEPPPVLHTTMLRVHPTPQSGTAENRLSEDTQAPTLFLELLSLSREKPWNLEMHPEE
KTPDLYPGLGPQDLLAASLTAVLLGGWIIFLMRQQQQLVEKEQQTLLAPADHPHISQNAQ
PPPSGATPQGQKKSLPSPSEQAQAVEEPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQ
LEGRAVAVKRLLRECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQ
EYVEKPELERWGLTPLMALQQLMSGLAHLHSLHIVHRDLKPANVLIAGPDGPDGTGRVVL
SDFGLCKKLPAGRYSFSLRSGIPGTEGWMAPELLQLLPSDSPTSAVDIFSAGCVFYYVLS
GGSHPFGESLYRQANILAGTPSLTHLEEEAHDKVVARNLVEAMLSPLPQARPLAHQVLAH
PFFWSRAKQLQFFQDVSDWLEKESERGPLVAALEAGGSAVVRGDWHKHISVPLQTDLRRF
RTYKGTSVRDLLRALRNKKHHYRELPAEVRQALGHVPDSFVQYFTARFPRLLLHTYGAMR
SCASESLFLPYYPPASSAGKSCPAGR
Download sequence
Identical sequences M3YL86
ENSMPUP00000012093 ENSMPUP00000012093 XP_004778391.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]