SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012126 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012126
Domain Number 1 Region: 349-522,556-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.95e-85
Family YicI catalytic domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 105-347
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-40
Family YicI N-terminal domain-like 0.0068
Further Details:      
 
Domain Number 3 Region: 723-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000137
Family Putative glucosidase YicI, domain 3 0.0061
Further Details:      
 
Domain Number 4 Region: 77-136
Classification Level Classification E-value
Superfamily Trefoil 0.00000000000068
Family Trefoil 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012126   Gene: ENSMPUG00000012223   Transcript: ENSMPUT00000012326
Sequence length 952
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:2227482:2242939:-1 gene:ENSMPUG00000012223 transcript:ENSMPUT00000012326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWPPSSRPLLGVCTFVSLATAVFLGHVLLRDFLVVPQEQRSFSRVPEQLYHTRQRGA
RDPGPQPTTGHHGSPRAAPSQCDVPPNSRFDCAPDKPITQEQCEARGCCYQPARQWPQVP
RMGQPWCFFPPSYPSYKLGNLTSTETGYTATLTRTSPTFFPKDILTLRLDLLLETESRLH
FTIKDPANRRYEVPLETPRVHSRASTTLYSVELREEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQHIVGLAEHLGSLTLSTSWTKITLWNRDIAPAPNVNLYGSHPFYLV
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGVLDVYIFLGPEPKSVVQQYLEIVGY
PFMPPYWGLGFHLCRWGYSSTAVTRQVVENMTRAHFPLDTQWNDLDYMDARRDFTFNTDG
FADFPAMVRELHQGGRRYVMIVDPAISSSSPPGSYRPYDEGLRRKVFITNETGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVSEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDNALEN
PPYVPGVVGGTLRAATVCASSRQFLSTHYNLHNLYGLTEALASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQEAMRKALGLRYALLPYLYLLFHRAHVLG
ETVARPLFLEFPEDPHTWTVDRQLLWGAALLITPVLEAGKVQVTGYFPPGTWYDLQMVPG
EAFGSSPCPPRAPLMSAIHSKGQWVTLPAPLDTINVHLRAGHIIPLQGPGLTTTESRKQP
MALLAALTVNGEARGELFWDDGESLGVLERGDYTEVTFLARNNTIVSELVRVTGEGAGLP
LRRVTVLGVAVAPSQVLSNGVPVSNFNYSPDTKTLDIPVSLLMGRQFVISWS
Download sequence
Identical sequences M3YLB9
ENSMPUP00000012126 XP_004748811.2.14098 XP_004748812.1.14098 ENSMPUP00000012126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]