SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012343 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012343
Domain Number 1 Region: 114-293
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.49e-28
Family NadC C-terminal domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 10-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 8.24e-25
Family NadC N-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012343   Gene: ENSMPUG00000012437   Transcript: ENSMPUT00000012544
Sequence length 306
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897085.1:1000346:1002184:1 gene:ENSMPUG00000012437 transcript:ENSMPUT00000012544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPPGLALLLPPTTLAALADSWLREDCPGLNHAALVTGAAPSQAVLWAKSPGVLAGRPFF
DAIFARVNCQVSWLLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGVASAAAA
AVEAAREAGWAGHVAGTRKTTPGFRLVEKYGLLVGGAKAHRYDLGGLVMVKDNHVVAAGG
VGEVRAAALLPQPRSGLPAAARLYWGPAPPTSPWGTVVAWEAGLLDPLLLLVSLQQLHPT
AAALKARFPGVGVEASGGITLVNLPRFCGPHIDVISLGMLTQAAPALDFSLKLFAEGTAP
VYPALP
Download sequence
Identical sequences M3YLY6
ENSMPUP00000012343 ENSMPUP00000012343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]