SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012713 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012713
Domain Number 1 Region: 51-500
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-101
Family ALDH-like 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012713   Gene: ENSMPUG00000012808   Transcript: ENSMPUT00000012917
Sequence length 501
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:4549614:4588576:1 gene:ENSMPUG00000012808 transcript:ENSMPUT00000012917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVPRQLCVHFARGSRLSGPWNRPAAFMSTLLINQAQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVKKAREAWRVWAEVPAPKRGEIVRQIGDA
LRENIQKLGNLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSETCKHVKIS
DQDPCFIKYVIVEVSWEMPICRWQNTFLFLASMVRSALSRKGAPTTSLISVAVTKIIAKV
LEDNQLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGNVSLET
GQQEPMLAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQI
RVGNPWDSNVLYGPLHTKQAVSMFLGAVEQAEKEGGTVVYGGKVMDRPGNYVEPTIVTGL
AHNASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSD
CGIVNVNIPTSGAEIGGAFGM
Download sequence
Identical sequences M3YN06
ENSMPUP00000012713 ENSMPUP00000012713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]