SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013181 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013181
Domain Number 1 Region: 56-407
Classification Level Classification E-value
Superfamily UROD/MetE-like 7.15e-118
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013181   Gene: ENSMPUG00000013279   Transcript: ENSMPUT00000013392
Sequence length 411
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:4475678:4479265:-1 gene:ENSMPUG00000013279 transcript:ENSMPUT00000013392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSDHVTFNMAPTLAPSRKGWSLISQTLVDVTVETARSYPRLIMEANGSGSQGFPELKN
DTFLRAAWGEDTDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRF
PLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLERLRDPATVTSELSYVFQ
AITLTRQQLAGRVPLIGFAGAPWTLMTYMIEGGGSSTMAQAKRWLYQKPQASHQLLRILT
DALVPYLVGQVAAGAQALQLFESHAGHLGPQLFSKFALPYIRDVAKQVKARLQEAGLAPV
PMIIFAKDGHFALEELAHAGYEVVGLDWTVAPKKARERVGKTVTLQGNLDPCALYASKEE
IGRLVQQMLDDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHRHSRLLRQN
Download sequence
Identical sequences M3YPC3
ENSMPUP00000013181 ENSMPUP00000013181 XP_004740514.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]