SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013223 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013223
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.54e-71
Family Alanine racemase-like, N-terminal domain 0.000000000782
Further Details:      
 
Domain Number 2 Region: 262-427
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.3e-49
Family Eukaryotic ODC-like 0.000000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013223   Gene: ENSMPUG00000013321   Transcript: ENSMPUT00000013434
Sequence length 461
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:6999078:7004681:-1 gene:ENSMPUG00000013321 transcript:ENSMPUT00000013434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFNNAELDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLATIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKISRLL
LERARELNIDIIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPADSGVSIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEEESNEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSTSIWGPTC
DGLDRIVERCDLPEMHVGDWMVFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQI
QSRDFPAELEEPDASPLPVSCARESGLKRPPATCASTSVNV
Download sequence
Identical sequences M3YPG5
ENSMPUP00000013223 XP_004745853.1.14098 ENSMPUP00000013223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]