SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013352 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000013352
Domain Number - Region: 424-507
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0419
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013352   Gene: ENSMPUG00000013454   Transcript: ENSMPUT00000013567
Sequence length 858
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:2025006:2224479:-1 gene:ENSMPUG00000013454 transcript:ENSMPUT00000013567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGRKWCPTYHPYGRSRTAAVAELGKPSRAEDGYFSHRPKEKVRTDSNNENSVPKDFEN
VDNSNFAPRTQKQKHQPELAKKAPSRQKELLKRKLEQEEKGKGHSFPGKGTNEVLPPGEK
ATVNSSRGKDAPGQPHARKSGGSSPELKQDQPPKCDISGKEAISALSRSKSKHCRQEIGE
TYCRHKLGLLMPKKVTRFCPLEGKANKNVQWDEDSVEYMLANPVRIAFVLVVHGRASRQL
QRMFKAIYHKDHFYYIHVDKKRSNYLHRQVLQFAGQYGNVRVTPWRMATIWGGASLLSTY
LQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRK
QGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRKFVEYVTFSTDDLVTKMKQFY
SYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKP
QDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENAYDEPDGT
HSLSDVALTLYHAFARLGLRRAESSLHVEGENSCRYYPMGHPASVHLYFLADRFQGFLIK
HHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLG
PMDEPVGMQKWGKGPNVTVTVIWVDPVNIIAATYDILIESTAEFTHYKPPLNLPLRPGVW
TVKILHHWVPVAETKFLVAPLTFSNRQPIRPEEALKLHNGPPRSAYMEQSFQSLNPVLSL
PISPAQVEQARRNAASTGAGLERWLDSLVGGMWTAMDVCATGPTACPVMQPCSQTAWSSS
SPDPKSELGAVKPDGRLR
Download sequence
Identical sequences M3YPU4
ENSMPUP00000013352 ENSMPUP00000013352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]