SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013508 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013508
Domain Number 1 Region: 457-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.11e-59
Family Eukaryotic proteases 0.0000377
Further Details:      
 
Domain Number 2 Region: 190-273
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-33
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 367-462
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-32
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 4 Region: 280-365
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-30
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 98-188
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-29
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 6 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.49e-17
Family Hairpin loop containing domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013508   Gene: ENSMPUG00000013611   Transcript: ENSMPUT00000013724
Sequence length 711
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:1008462:1013027:1 gene:ENSMPUG00000013611 transcript:ENSMPUT00000013724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTQCSEVPGQRSPLNDFQVLRGTELQHLRHTVGPGPWQEDVADAEECAGRC
GPLLDCRAFHYNVSSHGCQLLPWTQYSPYTQLQRSGRCDLFQKKNYVRTCIMDNGVKYRG
TVAITTGGLPCQHWSQRFPNDHKYTPTLRNGLEENFCRNPDRDPGGPWCYTTDPAVRFQS
CGIKSCREAACVWCNGEDYRGAVDRTESGRECQRWDLQRPHAHPFEPGKFLDKDLDDNYC
RNPDGSERPWCYTTDPQVEREFCDIPRCGSEAQPRQEATTLNCFRGKGEGYRGTANTTAA
GVPCQRWDAQNPHRHRFVPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRVAFCYQIPR
CADDLRPEDCYNGVGERYRGSVSRTRKGVACQHWSAEKPHKPQFTPTSAPDAHLEENFCR
NPDRDSHGPWCYTTDPGTPFDYCALRRCDADQPPSILEPPNQVVFEKCGKRVTRSHQQRS
RLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHVPLMGYEVWLGT
LFQNPQPGEPGLQQVPVAKMVCGPSGSQLVLLKLKRPVTLNQRVALICLPPERYVVPPGT
KCEIAGWGETKGTGNNEVLNVASLNVISNQECNVKHRGRVRENEMCTEGLLAPVGACEGD
YGGPLACFTHDCWVLEGIIIPNRVCARPRWPAIFMRVSVFTDWIHKVMRLG
Download sequence
Identical sequences M3YQ99
ENSMPUP00000013508 XP_004760697.1.14098 ENSMPUP00000013508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]