SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013641 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013641
Domain Number 1 Region: 396-744
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.56e-86
Family YicI catalytic domain-like 0.0000661
Further Details:      
 
Domain Number 2 Region: 746-828
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.02e-22
Family Putative glucosidase YicI, domain 3 0.0072
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000001
Family YicI N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013641   Gene: ENSMPUG00000013744   Transcript: ENSMPUT00000013858
Sequence length 966
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:2826666:2840484:1 gene:ENSMPUG00000013744 transcript:ENSMPUT00000013858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRSGAGLVLACLGVCLGVTLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDGLTVRLINEATKVVLVLELQGLQKNMTRIRIDELEPRRPRYRVSDVLV
ADPPTSRLSVSGRDENSVELTVAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLAFEH
QRAPRVPFSDKVSLTLGSIWDKIKNLFSRQGSKDPAEGGGAQPEEAPGDGDKPEETQGKA
EKDEPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYR
LYNLDVFQYELYNPMALYGSVPVLLAHSPHRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDVRWMSESGIIDVFLLLGPSAFDVFRQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPLTMLEHLAS
KRRKLVAIVDPHIKVDSGYRVHEELQSQGLYVKTRDGSDYEGWCWPGAAGYPDFTNPTMR
AWWANMFSFDNYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGFY
VHMATADGLVLRSGGLERPFVLSRAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGL
VGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPAQYHDIVR
DALGQRYSLLPFWYTLFYQAHREGIPVMRPLWVHYPQDVTTFSIDDQFLLGDALLVHPVS
DSGAHGVQVYLPGQGEVWYDIQSYQKHYGPQTLYLPVTLNTIPVFQRGGTIIPRWMRVRR
SSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNSLVSSSAD
PKGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGVSVASD
WSIHLR
Download sequence
Identical sequences M3YQN2
XP_004770346.1.14098 ENSMPUP00000013641 ENSMPUP00000013641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]