SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013687 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013687
Domain Number 1 Region: 30-207
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.44e-41
Family Peptidyl-tRNA hydrolase-like 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013687   Gene: ENSMPUG00000013790   Transcript: ENSMPUT00000013904
Sequence length 216
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:6821671:6823217:1 gene:ENSMPUG00000013790 transcript:ENSMPUT00000013904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGRATLGLRRAMRRSLSLGVLEPRPPGKRWLVAGLGNPGLPRTRHSVGLAVLGQLAQRL
GVADGWARDRHCAADLALASLGDAQLVLLRPRRLMNLNGITLERRAAELFGLTAEEVYLV
HDELDKPLGKLALKLGGSSRRGHNGVRSCIACLNSSAMPRLRVGIGRPSHPDMVQAHVLG
CFSAAEQELLPPLLERAADLLLDHIRERSQGPPPGF
Download sequence
Identical sequences M3YQS8
ENSMPUP00000013687 ENSMPUP00000013687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]